Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidase 2 (DPEP2)

Product Specifications

Abbreviation

Recombinant Human DPEP2 protein

Gene Name

DPEP2

UniProt

Q9H4A9

Expression Region

33-463aa

Organism

Homo sapiens (Human)

Target Sequence

AYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQGLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Dipeptidase that hydrolyzes leukotriene D4 (LTD4) into leukotriene E4 (LTE4) . Hydrolyzes cystinyl-bis-glycine. ; Independently of its dipeptidase activity can also modulate macrophage inflammatory response by acting as a regulator of NF-kappaB inflammatory signaling pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Mannose Binding Lectin (MBL)
RPU42678-01 50 µg

Recombinant Rat Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
Recombinant Rat Mannose Binding Lectin (MBL)
RPU42678-02 100 µg

Recombinant Rat Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
Recombinant Rat Mannose Binding Lectin (MBL)
RPU42678-03 1 mg

Recombinant Rat Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
AK4P5 Protein Vector (Human) (pPM-C-HA)
PV061703 500 ng

AK4P5 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (MaxLight 490)
134380-ML490 100 µL

TGFB1 (Transforming Growth Factor beta-1, TGF-beta-1, TGFB) (MaxLight 490)

Sign In for Pricing
View Details
Factor V antibody (biotin)
60R-1051 0.1 mg

Factor V antibody (biotin)

Sign In for Pricing
View Details