Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 5 (CD300LD), partial

Product Specifications

Product Name Alternative

CLM-5; CD300 antigen-like family member D; CMRF35-A4; CD antigen CD300d

Abbreviation

Recombinant Human CD300LD protein, partial

Gene Name

CD300LD

UniProt

Q6UXZ3

Expression Region

19-165aa

Organism

Homo sapiens (Human)

Target Sequence

AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERLIN1 (ER lipid raft associated 1, C10orf69, Endoplasmic reticulum lipid raft-associated protein 1, Erlin-1, KE04, KEO4, Protein KE04, SPFH1, SPFH domain-containing protein 1, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1)
S5401-09 100 µg

ERLIN1 (ER lipid raft associated 1, C10orf69, Endoplasmic reticulum lipid raft-associated protein 1, Erlin-1, KE04, KEO4, Protein KE04, SPFH1, SPFH domain-containing protein 1, Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 1)

Sign In for Pricing
View Details
Zinc finger protein with KRAB and SCAN domains 5 (ZKSCAN5) Mouse ELISA Kit
I4080 96 Tests

Zinc finger protein with KRAB and SCAN domains 5 (ZKSCAN5) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TTK Protein, N-His
orb2831917-01 20 µg

Recombinant Human TTK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TTK Protein, N-His
orb2831917-02 50 µg

Recombinant Human TTK Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TTK Protein, N-His
orb2831917-03 100 µg

Recombinant Human TTK Protein, N-His

Sign In for Pricing
View Details
Human CITED2 Recombinant Protein
PROTQ99967-50ug 50 µg

Human CITED2 Recombinant Protein

Sign In for Pricing
View Details