Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin D (CTSD)

Product Specifications

Abbreviation

Recombinant Human CTSD protein

Gene Name

CTSD

UniProt

P07339

Expression Region

21-412aa

Organism

Homo sapiens (Human)

Target Sequence

LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VPREB3 activation kit by CRISPRa
GA109276 1 Kit

Human VPREB3 activation kit by CRISPRa

Sign In for Pricing
View Details
Heme Oxygenase 1 (HO-1) Recombinant Rabbit Monoclonal Antibody [PSH02-76]
HA721854 100 µL

Heme Oxygenase 1 (HO-1) Recombinant Rabbit Monoclonal Antibody [PSH02-76]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]
E-AB-F1254J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]
E-AB-F1254J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]
E-AB-F1254J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL
BNC940612-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (115D8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details