Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Product Specifications

Product Name Alternative

T-lymphocyte differentiation antigen T8/Leu-2; CD antigen CD8a

Abbreviation

Recombinant Human CD8A protein, partial

Gene Name

CD8A

UniProt

P01732

Expression Region

22-182aa

Organism

Homo sapiens (Human)

Target Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs) . In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs) . This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3YL1 Rabbit Polyclonal Antibody
TA358989 100 µL

SH3YL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TOR1AIP1 Antibody
35097-01 50 µL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
TOR1AIP1 Antibody
35097-02 100 µL

TOR1AIP1 Antibody

Sign In for Pricing
View Details
NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714)
130575 100 µg

NRP2 (Neuropilin-2, VEGF165R2, Vascular Endothelial Cell Growth Factor 165 Receptor 2, MGC126574, NP2, NPN2, PRO2714)

Sign In for Pricing
View Details
General 1,3-beta-D-glucan (BDG) ELISA Kit
CK-bio-24535-01 48 Tests

General 1,3-beta-D-glucan (BDG) ELISA Kit

Sign In for Pricing
View Details
General 1,3-beta-D-glucan (BDG) ELISA Kit
CK-bio-24535-02 96 Tests

General 1,3-beta-D-glucan (BDG) ELISA Kit

Sign In for Pricing
View Details