Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Arginase-1 (ARG1)

Product Specifications

Product Name Alternative

Liver-type arginase; Type I arginase

Abbreviation

Recombinant Human ARG1 protein

Gene Name

ARG1

UniProt

P05089

Expression Region

1-322aa

Organism

Homo sapiens (Human)

Target Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys. ; Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN) . Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion. In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival. In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha V Recombinant Rabbit Monoclonal Antibody [SC56-07]
ET1610-15 100 µL

Integrin alpha V Recombinant Rabbit Monoclonal Antibody [SC56-07]

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF806332 100 µg

CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI2B5]

Sign In for Pricing
View Details
1,2-Distearoyl-sn-glycerol
TRC-D493515-500MG 500 mg

1,2-Distearoyl-sn-glycerol

Sign In for Pricing
View Details
Ube2u Mouse Gene Knockout Kit (CRISPR)
KN518592 1 Kit

Ube2u Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calponin-1 (CALP), 0.2mg/mL
BNUB0831-100 1x 100 µL

Calponin-1 (CALP), 0.2mg/mL

Sign In for Pricing
View Details
ERI3 (NM_001301700) Human Tagged ORF Clone
RG236587 10 µg

ERI3 (NM_001301700) Human Tagged ORF Clone

Sign In for Pricing
View Details