Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon alpha-4 (Ifna4)

Product Specifications

Product Name Alternative

IFN-alpha-4

Abbreviation

Recombinant Mouse Ifna4 protein

Gene Name

Ifna4

UniProt

P07351

Expression Region

25-186aa

Organism

Mus musculus (Mouse)

Target Sequence

CDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS6-AS1 AAV Vector (Human) (CMV)
21323101 1 µg

GAS6-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Canine 9 alpha, 11 beta PGF2 alpha (9α, 11β PGF2α) ELISA Kit
EIA06675Ca 1 Kit

Canine 9 alpha, 11 beta PGF2 alpha (9α, 11β PGF2α) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit for Endothelial protein C receptor (EPCR)
TRV-0004251-01 24 Tests

ELISA Kit for Endothelial protein C receptor (EPCR)

Sign In for Pricing
View Details
ELISA Kit for Endothelial protein C receptor (EPCR)
TRV-0004251-02 48 Tests

ELISA Kit for Endothelial protein C receptor (EPCR)

Sign In for Pricing
View Details
ELISA Kit for Endothelial protein C receptor (EPCR)
TRV-0004251-03 96 Tests

ELISA Kit for Endothelial protein C receptor (EPCR)

Sign In for Pricing
View Details
ELISA Kit for Endothelial protein C receptor (EPCR)
TRV-0004251-04 5x 96 Tests

ELISA Kit for Endothelial protein C receptor (EPCR)

Sign In for Pricing
View Details