Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MAP kinase-activating death domain protein (MADD), partial

Product Specifications

Product Name Alternative

Differentially expressed in normal and neoplastic cells; Insulinoma glucagonoma clone 20; Rab3 GDP/GTP exchange factor; RabGEF; Rab3 GDP/GTP exchange protein; Rab3GEP

Abbreviation

Recombinant Human MADD protein, partial

Gene Name

MADD

UniProt

Q8WXG6

Expression Region

1409-1506aa

Organism

Homo sapiens (Human)

Target Sequence

YSQQINEVLDQLANLNGRDLSIWSSGSRHMKKQTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRRNGSETQ

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Guanyl-nucleotide exchange factor that regulates small GTPases of the Rab family. Converts GDP-bound inactive form of RAB27A and RAB27B to the GTP-bound active forms. Converts GDP-bound inactive form of RAB3A, RAB3C and RAB3D to the GTP-bound active forms, GTPases involved in synaptic vesicle exocytosis and vesicle secretion. Plays a role in synaptic vesicle formation and in vesicle trafficking at the neuromuscular junction. Involved in up-regulating a post-docking step of synaptic exocytosis in central synapses. Probably by binding to the motor proteins KIF1B and KIF1A, mediates motor-dependent transport of GTP-RAB3A-positive vesicles to the presynaptic nerve terminals. Plays a role in TNFA-mediated activation of the MAPK pathway, including ERK1/2. May link TNFRSF1A with MAP kinase activation. May be involved in the regulation of TNFA-induced apoptosis.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chitosan Oligosaccharide Hydrochloride Salt (Technical Grade)
TRC-C315018-50G 50 g

Chitosan Oligosaccharide Hydrochloride Salt (Technical Grade)

Sign In for Pricing
View Details
Fluo -4 K+ Salt - Green fluorescent calcium indicator
1042F 10x 50 µg

Fluo -4 K+ Salt - Green fluorescent calcium indicator

Sign In for Pricing
View Details
Human MMEL1 activation kit by CRISPRa
GA112418 1 Kit

Human MMEL1 activation kit by CRISPRa

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF647 conjugate, 0.1mg/mL
BNC472060-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALP-streptavidin conjugate [Streptavidin-alkaline phosphatase conjugate]
16921-AAT 1 mg

ALP-streptavidin conjugate [Streptavidin-alkaline phosphatase conjugate]

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody
AN300373L-01 20 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser235, 236) Monoclonal Antibody

Sign In for Pricing
View Details