Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysine-specific demethylase 6A (Kdm6a), partial

Product Specifications

Product Name Alternative

Histone demethylase UTX; Ubiquitously transcribed TPR protein on the X chromosome; Ubiquitously transcribed X chromosome tetratricopeptide repeat protein; [histone H3]-trimethyl-L-lysine

Abbreviation

Recombinant Mouse Kdm6a protein, partial

Gene Name

Kdm6a

UniProt

O70546

Expression Region

1095-1258aa

Organism

Mus musculus (Mouse)

Target Sequence

KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A. Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cattle Decorin (DCN) ELISA Kit
orb2667080-01 48 Tests

Cattle Decorin (DCN) ELISA Kit

Sign In for Pricing
View Details
Cattle Decorin (DCN) ELISA Kit
orb2667080-02 96 Tests

Cattle Decorin (DCN) ELISA Kit

Sign In for Pricing
View Details
Anti-TNAP antibody
STJ96048 200 µl

Anti-TNAP antibody

Sign In for Pricing
View Details
Human BLC1 ELISA Kit
EHB0314 96 Tests

Human BLC1 ELISA Kit

Sign In for Pricing
View Details
Glypican 1 Rabbit Polyclonal Antibody
orb544683-01 50 μL

Glypican 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glypican 1 Rabbit Polyclonal Antibody
orb544683-02 100 µL

Glypican 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details