Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Integration host factor subunit alpha (ihfA)

Product Specifications

Product Name Alternative

IHF-alpha

Abbreviation

Recombinant E.coli ihfA protein

Gene Name

IhfA

UniProt

B6I8Q5

Expression Region

1-99aa

Organism

Escherichia coli (strain SE11)

Target Sequence

MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PET117 (NM_001164811) Human Tagged ORF Clone
RC228028 10 µg

PET117 (NM_001164811) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human QKI Polyclonal Antibody
HP249014-01 50 µg

Anti-Human QKI Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human QKI Polyclonal Antibody
HP249014-02 100 µg

Anti-Human QKI Polyclonal Antibody

Sign In for Pricing
View Details
Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9915R-BF488 100 µL

Alpha 1 acid glycoprotein 2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Complete Medium for Human Rectal Smooth Muscle Cells
abx703952-01 100 mL

Complete Medium for Human Rectal Smooth Muscle Cells

Sign In for Pricing
View Details
Complete Medium for Human Rectal Smooth Muscle Cells
abx703952-02 500 mL

Complete Medium for Human Rectal Smooth Muscle Cells

Sign In for Pricing
View Details