Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cathelicidin antimicrobial peptide (Camp)

Product Specifications

Product Name Alternative

Cathelin-like protein; CLP; Cramp

Abbreviation

Recombinant Mouse Camp protein

Gene Name

Camp

UniProt

P51437

Expression Region

135-172aa

Organism

Mus musculus (Mouse)

Target Sequence

ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Binds to bacterial lipopolysaccharides (LPS) and has antibacterial activity. Acts via neutrophil N-formyl peptide receptors to enhance the release of CXCL2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTMA Polyclonal Antibody
A70932-100 100 µL

PTMA Polyclonal Antibody

Sign In for Pricing
View Details
WISP1 (Wnt1-inducible-signaling Pathway Protein 1, WISP-1, CCN Family Member 4, Wnt-1-induced Secreted Protein, CCN4) discontinued
W1450-51A 50 µg

WISP1 (Wnt1-inducible-signaling Pathway Protein 1, WISP-1, CCN Family Member 4, Wnt-1-induced Secreted Protein, CCN4) discontinued

Sign In for Pricing
View Details
Phospho-G3BP1 (Ser232) Antibody
CSB-PA908450 100 µL

Phospho-G3BP1 (Ser232) Antibody

Sign In for Pricing
View Details
Mouse 5-HT (5-Hydroxytryptamine) ELISA Kit
EK248641 96 Well

Mouse 5-HT (5-Hydroxytryptamine) ELISA Kit

Sign In for Pricing
View Details
CCP3 HDR Plasmid (m)
sc-429278-HDR 20 µg

CCP3 HDR Plasmid (m)

Sign In for Pricing
View Details
NEFL Immunizing Peptide
MBS428859-01 0.1 mg

NEFL Immunizing Peptide

Sign In for Pricing
View Details