Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD79A&CD79B Heterodimer Protein (Active)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human CD79A&CD79B Heterodimer protein (Active)

Gene Name

CD79A&CD79B

UniProt

P11912&P40259

Expression Region

33-143aa&29-159aa

Organism

Homo sapiens (Human)

Target Sequence

LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Tag

C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

/

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody (CSB-RA004957MA1HU) . The EC50 is 8.012-9.339 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody (CSB-RA004958MA2HU) . The EC50 is 14.85-17.47 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.3 kDa&43.1 kDa

References & Citations

/

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Heterodimer

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MKNK2 polyclonal antibody
BS61755 50ul

MKNK2 polyclonal antibody

Sign In for Pricing
View Details
CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID, Calcium/calmodulin-dependent Protein kinase type 1D, CaM-K1, Camk1D, CaMKID, CaMKI delta, CaMKI-delta, CaM-KI delta, CamKI-like protein kinase, CaM kinase ID, CaM kinase I delta, CKLiK) (MaxLight 650)
124281-ML650 100 µL

CAMK1D (Calcium/Calmodulin-dependent Protein Kinase ID, Calcium/calmodulin-dependent Protein kinase type 1D, CaM-K1, Camk1D, CaMKID, CaMKI delta, CaMKI-delta, CaM-KI delta, CamKI-like protein kinase, CaM kinase ID, CaM kinase I delta, CKLiK) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)
MBS7008506-01 0.02 mg

Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Sign In for Pricing
View Details
Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)
MBS7008506-02 0.1 mg

Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Sign In for Pricing
View Details
Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)
MBS7008506-03 5x 0.1 mg

Recombinant Bovine V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Sign In for Pricing
View Details
MICA Antibody
orb2809457 100 µL

MICA Antibody

Sign In for Pricing
View Details