Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)

Product Specifications

Product Name Alternative

B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b

Abbreviation

Recombinant Human CD79B protein, partial (Active)

Gene Name

CD79B

UniProt

P40259

Expression Region

29-159aa

Organism

Homo sapiens (Human)

Target Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Tag

C-terminal 10xHis-mFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody (CSB-RA004958MA2HU) . The EC50 is 31.97-35.69 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.1 kDa

References & Citations

Initial characterization of the human central proteome. Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Fractionation Antibody Sampler Kit
HAK21080 1 Kit

Cell Fractionation Antibody Sampler Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Gastroesophageal junction
CS643887 5x 5 µm

Frozen Tissue Sections, Gastroesophageal junction

Sign In for Pricing
View Details
Mouse Abhd13 activation kit by CRISPRa
GA207972 1 Kit

Mouse Abhd13 activation kit by CRISPRa

Sign In for Pricing
View Details
CD59 (NM_000611) Human Recombinant Protein
TP318343L 1 mg

CD59 (NM_000611) Human Recombinant Protein

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF594 conjugate, 0.1mg/mL
BNC941645-500 1x 500 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spink2 Mouse Gene Knockout Kit (CRISPR)
KN516616 1 Kit

Spink2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details