Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40 ligand (Cd40lg), partial

Product Specifications

Product Name Alternative

CD40-L; T-cell antigen Gp39; TNF-related activation protein (TRAP) ; Tumor necrosis factor ligand superfamily member 5

Abbreviation

Recombinant Mouse Cd40lg protein, partial

Gene Name

Cd40lg

UniProt

P27548

Expression Region

112-260aa

Organism

Mus musculus (Mouse)

Target Sequence

MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Tag

N-terminal mFc1-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. ; [CD40 ligand, soluble form]: Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS706170 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI9G7]
CF808851 100 µg

Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI9G7]

Sign In for Pricing
View Details
TTLL5 Rabbit Polyclonal Antibody
TA370817 100 µL

TTLL5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR52A5 Human Gene Knockout Kit (CRISPR)
KN421506 1 Kit

OR52A5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM Rabbit Polyclonal Antibody
R1511-23 100 µL

Human IgM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PBXIP1 Polyclonal Antibody
E-AB-52665-01 20 µL

PBXIP1 Polyclonal Antibody

Sign In for Pricing
View Details