Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cavia porcellus Lipocalin Cav p 2.0101 (Lcncavp2)

Product Specifications

Product Name Alternative

Major allergen Cav p 2; allergen Cav p 2.0101

Abbreviation

Recombinant Guinea pig Lcncavp2 protein

Gene Name

Lcncavp2

UniProt

P83508

Expression Region

17-170aa

Organism

Cavia porcellus (Guinea pig)

Target Sequence

DSIDYSKVPGNWRTIAIAADHVEKIEVNGELRAYFRQVDCTEGCDKISITFYTNTDGVCTEHTVVGARNGENDVYTVDYAGENTFQILCNSDDAFVIGSVNTDQNGQTTKEVAIAAKRNFLTPEQEQKFQKAVQNAGIPLENIRYVIETDTCPD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPEB4 Antibody, Biotin conjugated
A54874-50UG 50 µg

CPEB4 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human Osteoclast Associated Receptor ELISA Kit
MBS730248-01 48 Well

Human Osteoclast Associated Receptor ELISA Kit

Sign In for Pricing
View Details
Human Osteoclast Associated Receptor ELISA Kit
MBS730248-02 96 Well

Human Osteoclast Associated Receptor ELISA Kit

Sign In for Pricing
View Details
Human Osteoclast Associated Receptor ELISA Kit
MBS730248-03 5x 96 Well

Human Osteoclast Associated Receptor ELISA Kit

Sign In for Pricing
View Details
Human Osteoclast Associated Receptor ELISA Kit
MBS730248-04 10x 96 Well

Human Osteoclast Associated Receptor ELISA Kit

Sign In for Pricing
View Details
Fish Phosphatidylinositol 3-Kinase Regulatory Subunit Alpha (PIK3R1) ELISA Kit
MBS9928450 Inquire

Fish Phosphatidylinositol 3-Kinase Regulatory Subunit Alpha (PIK3R1) ELISA Kit

Sign In for Pricing
View Details