Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Insulin-1 (Ins1)

Product Specifications

Abbreviation

Recombinant Rat Ins1 protein

Gene Name

Ins1

UniProt

P01322

Expression Region

25-54aa&90-110aa

Organism

Rattus norvegicus (Rat)

Target Sequence

FVKQHLCGPHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Mouse CD119 Antibody[GR-20]
E-AB-F1115E-01 50 Tests

APC Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
APC Anti-Mouse CD119 Antibody[GR-20]
E-AB-F1115E-02 100 Tests

APC Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
APC Anti-Mouse CD119 Antibody[GR-20]
E-AB-F1115E-03 2x 100 Tests

APC Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
Recombinant Mouse EphA7/EHK3 Protein (His Tag)
PKSM040593 200 µg

Recombinant Mouse EphA7/EHK3 Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UQ-01 25 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097UQ-02 100 µg

Elab Fluor® Violet 450 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details