Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse CD40 ligand (Cd40lg), partial (Active)

Product Specifications

Product Name Alternative

CD40 ligand; CD40-L; T-cell antigen Gp39TNF-related activation protein (TRAP) ; Tumor necrosis factor ligand superfamily member 5; CD154; Cd40lg; Cd40l, Tnfsf5

Abbreviation

Recombinant Mouse Cd40lg protein, partial (Active)

Gene Name

Cd40lg

UniProt

P27548

Expression Region

112-260aa

Organism

Mus musculus (Mouse)

Target Sequence

MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL

Tag

N-terminal mFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cytokine that acts as a ligand to CD40/TNFRSF5. Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B. Induces the activation of kinases MAPK8 and PAK2 in T-cells. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. CD40 ligand, soluble form Acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3; both integrins and the CD40 receptor are required for activation of CD40-CD40LG signaling, which have cell-type dependent effects, such as B-cell activation, NF-kappa-B signaling and anti-apoptotic signaling.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40 (CSB-MP004936MO1) at 2 μg/mL can bind Mouse Cd40lg.The EC50 is 5.121-6.085 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.1 kDa

References & Citations

+

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti - Telomeric Repeat Binding Factor 1 (TRF1, RAP1)
MBS619717-01 0.1 mL

Anti - Telomeric Repeat Binding Factor 1 (TRF1, RAP1)

Sign In for Pricing
View Details
Anti - Telomeric Repeat Binding Factor 1 (TRF1, RAP1)
MBS619717-02 5x 0.1 mL

Anti - Telomeric Repeat Binding Factor 1 (TRF1, RAP1)

Sign In for Pricing
View Details
LYPLA1, Recombinant, Mouse, aa1-230, His-Tag (Acyl-protein thioesterase 1)
350053-01 100 µg

LYPLA1, Recombinant, Mouse, aa1-230, His-Tag (Acyl-protein thioesterase 1)

Sign In for Pricing
View Details
LYPLA1, Recombinant, Mouse, aa1-230, His-Tag (Acyl-protein thioesterase 1)
350053-02 500 µg

LYPLA1, Recombinant, Mouse, aa1-230, His-Tag (Acyl-protein thioesterase 1)

Sign In for Pricing
View Details
CKAP2 Rabbit Polyclonal Antibody (BF680)
orb2390607 100 µL

CKAP2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Rpf2 3'UTR Luciferase Stable Cell Line
TU219606 1.0 mL

Rpf2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details