Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gastric inhibitory polypeptide receptor (Gipr), partial

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide receptor

Abbreviation

Recombinant Mouse Gipr protein, partial

Gene Name

Gipr

UniProt

Q0P543

Expression Region

19-134aa

Organism

Mus musculus (Mouse)

Target Sequence

ETDSEGQTTTGELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQTLILERLQ

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E33P CRISPRa sgRNA lentivector (set of three targets)(Human)
35607121 3x 1.0µg DNA

OR7E33P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PCNA Mouse mAb, Pacific Blue conjugated
orb2884325 100 µL

PCNA Mouse mAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse Cerebellar degeneion related protein 2 (CDR2) ELISA Kit
GTR10359445 96 Well

Mouse Cerebellar degeneion related protein 2 (CDR2) ELISA Kit

Sign In for Pricing
View Details
IDH3B discontinued
390277 200 µL

IDH3B discontinued

Sign In for Pricing
View Details
IMP3 Rabbit Polyclonal Antibody (Biotin)
orb450433 100 µL

IMP3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PEAR1, CT (PEAR1, MEGF12, Platelet endothelial aggregation receptor 1, Multiple epidermal growth factor-like domains protein 12) (MaxLight 550) discontinued
039866-ML550 100 µL

PEAR1, CT (PEAR1, MEGF12, Platelet endothelial aggregation receptor 1, Multiple epidermal growth factor-like domains protein 12) (MaxLight 550) discontinued

Sign In for Pricing
View Details