Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early activation antigen CD69 (CD69), partial

Product Specifications

Product Name Alternative

Activation inducer molecule) (AIM) (BL-AC/P26) (C-type lectin domain family 2 member C) (EA1) (Early T-cell activation antigen p60) (GP32/28) (Leukocyte surface antigen Leu-23) (MLR-3) (CD antigen CD69)

Abbreviation

Recombinant Human CD69 protein, partial

Gene Name

CD69

UniProt

Q07108

Expression Region

62-199aa

Organism

Homo sapiens (Human)

Target Sequence

SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGGT1B Polyclonal Antibody, RBITC Conjugated
bs-9372R-RBITC 100 µL

PGGT1B Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (HRP)
247620-HRP 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (HRP)

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)
MBS1164914-01 0.02 mg (E-Coli)

Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)
MBS1164914-02 0.1 mg (E-Coli)

Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)
MBS1164914-03 0.02 mg (Yeast)

Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)
MBS1164914-04 0.1 mg (Yeast)

Recombinant Chlamydia muridarum Probable DNA-binding protein HU (hup)

Sign In for Pricing
View Details