Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell adhesion molecule CEACAM5 (CEACAM5), partial

Product Specifications

Product Name Alternative

Carcinoembryonic antigen; Carcinoembryonic antigen-related cell adhesion molecule 5 (CEA cell adhesion molecule 5; Meconium antigen 100

Abbreviation

Recombinant Human CEACAM5 protein, partial

Gene Name

CEACAM5

UniProt

P06731

Expression Region

35-685aa

Organism

Homo sapiens (Human)

Target Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Cell surface glycoprotein that plays a role in cell adhesion, intracellular signaling and tumor progression. Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. Plays a role as an oncogene by promoting tumor progression; induces resistance to anoikis of colorectal carcinoma cells.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

100.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-01 0.02 mg (E-Coli)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-02 0.1 mg (E-Coli)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-03 0.02 mg (Yeast)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-04 0.1 mg (Yeast)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-05 0.02 mg (Baculovirus)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)
MBS1160084-06 0.02 mg (Mammalian-Cell)

Recombinant Borrelia burgdorferi Decorin-binding protein A (dbpA)

Sign In for Pricing
View Details