Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Single Ig IL-1-related receptor (SIGIRR), partial

Product Specifications

Product Name Alternative

Single Ig IL-1R-related molecule; Single immunoglobulin domain-containing IL1R-related protein; Toll/interleukin-1 receptor 8; TIR8

Abbreviation

Recombinant Human SIGIRR protein, partial

Gene Name

SIGIRR

UniProt

Q6IA17

Expression Region

1-118aa

Organism

Homo sapiens (Human)

Target Sequence

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FCRL2 activation kit by CRISPRa
GA112434 1 Kit

Human FCRL2 activation kit by CRISPRa

Sign In for Pricing
View Details
FP100 (FAAP100) Rabbit Polyclonal Antibody
TA374128 100 µL

FP100 (FAAP100) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A13 Rabbit Polyclonal Antibody
TA362099 100 µL

SLC6A13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF594 conjugate, 0.1mg/mL
BNC942386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GMPR Polyclonal Antibody
E-AB-65884-01 60 µL

GMPR Polyclonal Antibody

Sign In for Pricing
View Details
GMPR Polyclonal Antibody
E-AB-65884-02 120 µL

GMPR Polyclonal Antibody

Sign In for Pricing
View Details