Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Nectin cell adhesion molecule 2 (NECTIN2), partial (Active)

Product Specifications

Product Name Alternative

Nectin cell adhesion molecule 2; NECTIN2

Abbreviation

Recombinant Cynomolgus monkey NECTIN2 protein, partial (Active)

Gene Name

NECTIN2

UniProt

A0A2K5U084

Expression Region

32-360aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSQRLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

/

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis NECTIN2 at 2 μg/mL can bind Anti-NECTIN2 recombinant antibody (CSB-RA835690MA1HU) . The EC50 is 1.011-1.193 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.9 kDa

References & Citations

/

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Ionized Calcium-binding Adapter Molecule 1 (IBA1), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029152 96 Tests

Multiplex Assay Kit for Ionized Calcium-binding Adapter Molecule 1 (IBA1), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)
SIPD957Ra02-01 10 µg

Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)

Sign In for Pricing
View Details
Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)
SIPD957Ra02-02 50 µg

Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)

Sign In for Pricing
View Details
Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)
SIPD957Ra02-03 200 µg

Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)

Sign In for Pricing
View Details
Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)
SIPD957Ra02-04 1 mg

Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)

Sign In for Pricing
View Details
Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)
SIPD957Ra02-05 5 mg

Recombinant Myosin Heavy Chain 11, Smooth Muscle (MYH11)

Sign In for Pricing
View Details