Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain; CD3e

Abbreviation

Recombinant Human CD3E protein, partial

Gene Name

CD3E

UniProt

P07766

Expression Region

23-126aa

Organism

Homo sapiens (Human)

Target Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

The CD3 complex mediates signal transduction.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Complement Component C5/C5a Antibody (06)
NBP3-06182-100ul 100 µL

Mouse Monoclonal Complement Component C5/C5a Antibody (06)

Sign In for Pricing
View Details
SLC4A10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV692134 1.0 µg DNA

SLC4A10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit
MBS2905750-01 48 Well

Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit
MBS2905750-02 96 Well

Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit
MBS2905750-03 5x 96 Well

Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit
MBS2905750-04 10x 96 Well

Mouse Dnaja3 / DnaJ homolog subfamily A member 3, mitochondrial ELISA Kit

Sign In for Pricing
View Details