Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-5 protein (GJA5) -VLPs

Product Specifications

Product Name Alternative

Connexin-40; Cx40

Abbreviation

Recombinant Human GJA5 protein-VLPs

Gene Name

GJA5

UniProt

P36382

Expression Region

1-358aa

Organism

Homo sapiens (Human)

Target Sequence

MGDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGCQNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTTLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV

Tag

C-terminal 10xHis-tagged

Type

MP-VLP Transmembrane Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Endotoxin

Not test

Purity

The purity information is not available for VLPs proteins.

Activity

Not Test

Bioactivity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psg23 Mouse Gene Knockout Kit (CRISPR)
KN514081 1 Kit

Psg23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
RDR-SDF1-Mu-01 96 Tests

Mouse Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
RDR-SDF1-Mu-02 48 Tests

Mouse Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Dlx6 activation kit by CRISPRa
GA201088 1 Kit

Mouse Dlx6 activation kit by CRISPRa

Sign In for Pricing
View Details
DDT Rabbit Polyclonal Antibody
TA371863 100 µL

DDT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E3]
TA500865AM 100 µL

LOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details