Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Seoul virus Envelopment polyprotein (GP), partial

Product Specifications

Product Name Alternative

M polyprotein

Abbreviation

Recombinant Seoul virus GP protein, partial

Gene Name

GP

UniProt

P33455

Expression Region

18-484aa

Organism

Seoul virus (strain 80-39)

Target Sequence

KNVFDMRIQCPHSVKFGETSVSGYTELPPLSLQEAEQLVPESSCNMDNHQSLSTINKLTKVIWRKKANQESANQNSFELMESEVSFKGLCMLKHRMVEESYRNRRSVICYDLACNSTFCKPTVYMIVPIHACNMMKSCLIGLGPYRVQVVYERTYCTTGILTEGKCFVPDKAVVSALKRGMYAIASIETICFFIHQKGNTYKIVTAITSAMGSKCNNTDTKVQGYYICIIGGNSAPVYAPAGEDFRAMEVFSGIITSPHGEDHDLPGEEIATYQISGQIEAKIPHTVSSKNLKLTAFAGIPSYSSTSILTASEDGRFIFSPGLFPNLNQSVCDNNALPLIWRGLIDLTGYYEAVHPCNVFCVLSGPGASCEAFSEGGIFNITSPMCLVSKQNRFRAAEQQISFVCQRVDMDIIVYCNGQKKTILTKTLVIGQCIYTITSLFSLLPGVAHSIAIELCVPGFHGWATAA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Forms homotetramers with glycoprotein C at the surface of the virion. Attaches the virion to host cell receptors including integrin ITGAV/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Mediates the assembly and budding of infectious virus particles through its interaction with the nucleocapsid protein and the viral genome. May dysregulate normal immune and endothelial cell responses through an ITAM motif. Translocates to mitochondria, binds to host TUFM and recruits MAP1LC3B. These interactions induce mitochondrial autophagy and therefore destruction of host MAVS leading to inhibition of type I interferon (IFN) responses. Concomitant breakdown of glycoprotein N is apparently prevented by the nucleoprotein that may inhibit Gn-stimulated autophagosome-lysosome fusion. Interacts with the viral genomic RNA. ; [Glycoprotein C]: Forms homotetramers with glycoprotein N at the surface of the virion. Attaches the virion to host cell receptors including integrin ITGAV/ITGB3. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Class II fusion protein that promotes fusion of viral membrane with host endosomal membrane after endocytosis of the virion.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (HRP)
MBS6501326-01 0.1 mL

Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (HRP)

Sign In for Pricing
View Details
Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (HRP)
MBS6501326-02 5x 0.1 mL

Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (HRP)

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7208243-01 48 Well

Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7208243-02 96 Well

Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7208243-03 5x 96 Well

Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details
Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit
MBS7208243-04 10x 96 Well

Rat Coiled-coil domain-containing protein 91 (CCDC91) ELISA Kit

Sign In for Pricing
View Details