Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Conus radiatus Iota-conotoxin-like r11c

Product Specifications

Product Name Alternative

R11.4

Abbreviation

Recombinant Conus radiatus Iota-conotoxin-like r11c protein

UniProt

Q7Z096

Expression Region

37-79aa

Organism

Conus radiatus (Rayed cone)

Target Sequence

GPSFCKADEKPCKYHADCCNCCLGGICKPSTSWIGCSTNVFLT

Tag

N-terminal 6xHis-sumostar-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Iota-conotoxins bind to voltage-gated sodium channels (Nav) and act as agonists by shifting the voltage-dependence of activation to more hyperpolarized levels. Causes circular motion, convulsions, copious urination, rigid paralysis and death upon intracranial injection into mice. Causes unbalanced swimming, swimming in diagonal and vertical motion and death, when injected intraperitoneally into goldfish. L-Leu and D-Leu forms are active on both nerve and muscle.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 Antibody (HRP)
KH-1802-01 50 μL

CD6 Antibody (HRP)

Sign In for Pricing
View Details
CD6 Antibody (HRP)
KH-1802-02 100 µL

CD6 Antibody (HRP)

Sign In for Pricing
View Details
CD6 Antibody (HRP)
KH-1802-03 1 mL

CD6 Antibody (HRP)

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF740 conjugate, 0.1mg/mL
BNC742074-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gys1 (NM_030678) Mouse Recombinant Protein
TP510381 20 µg

Gys1 (NM_030678) Mouse Recombinant Protein

Sign In for Pricing
View Details
DGKA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H10]
TA504069AM 100 µL

DGKA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H10]

Sign In for Pricing
View Details