Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)
Product Specifications
Product Name Alternative
CD18; D12S370; LT beta R; LTBETAR; Ltbr; Lymphotoxin B receptor; Lymphotoxin beta receptor (TNFR superfamily; member 3) ; Lymphotoxin beta receptor; Lymphotoxin-beta receptor; TNF R III; TNF-RIII; TNFCR; TNFR RP; TNFR superfamily member 3; TNFR-III; TNFR2 RP; TNFR2RP; TNFR3; TNFRII; TNFRRP; TNFRSF 3; TNFRSF3; TNR3_HUMAN; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2 related protein; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; Tumor necrosis factor receptor superfamily member 3 precursor; Tumor necrosis factor receptor type III
Abbreviation
Recombinant Human LTBR protein, partial (Active)
Gene Name
LTBR
UniProt
P36941
Expression Region
31-227aa
Organism
Homo sapiens (Human)
Target Sequence
QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM
Tag
C-terminal 10xHis-tagged
Type
Active Protein & In Stock Protein
Source
Mammalian cell
Field of Research
Cell Biology
Relevance
Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) . Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Yes
Bioactivity
①Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Anti-LTBR recombinant antibody (CSB-RA013227MA1HU), the EC50 is 0.6450-0.8200 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 4.399-5.172 ng/ml.
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
23.1 kDa
References & Citations
Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items