Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcH5b/UBE2D2, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UbcH5b/UBE2D2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubch5b-ube2d2-protein-human.html

Purity

98.0

Smiles

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Molecular Formula

7322 (Gene_ID) P62837-1 (M1-M147) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dimepranol-d6
TRC-D460402-5MG 5 mg

Dimepranol-d6

Sign In for Pricing
View Details
Human C9orf72 activation kit by CRISPRa
GA116437 1 Kit

Human C9orf72 activation kit by CRISPRa

Sign In for Pricing
View Details
C19orf77 (SMIM24) Human Gene Knockout Kit (CRISPR)
KN427161 1 Kit

C19orf77 (SMIM24) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IPPK (NM_022755) Human Over-expression Lysate
LC402937 20 µg

IPPK (NM_022755) Human Over-expression Lysate

Sign In for Pricing
View Details
Orbital Shaker BSOT-1603
BSOT-1603 1 Unit

Orbital Shaker BSOT-1603

Sign In for Pricing
View Details
HBS1L (NM_001145158) Human Over-expression Lysate
LY428733 100 µg

HBS1L (NM_001145158) Human Over-expression Lysate

Sign In for Pricing
View Details