Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcH5b/UBE2D2, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UbcH5b/UBE2D2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubch5b-ube2d2-protein-human.html

Purity

98.0

Smiles

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Molecular Formula

7322 (Gene_ID) P62837-1 (M1-M147) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15E11]
TA806033BM 100 µL

Factor I (CFI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI15E11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502287 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
(6Beta,17Alpha)-19-Norpregna-1,3,5(10)-trien-20-yne-6,17-diol 6-(4-Nitrobenozoate)
TRC-N825090-1MG 1 mg

(6Beta,17Alpha)-19-Norpregna-1,3,5(10)-trien-20-yne-6,17-diol 6-(4-Nitrobenozoate)

Sign In for Pricing
View Details
Western Blot Boxes
B1204 6 Units/Pack

Western Blot Boxes

Sign In for Pricing
View Details
Steap2 Mouse Gene Knockout Kit (CRISPR)
KN516856 1 Kit

Steap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexachlorobenzene
TRC-H290815-10G 10 g

Hexachlorobenzene

Sign In for Pricing
View Details