Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcH5b/UBE2D2, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UbcH5b/UBE2D2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubch5b-ube2d2-protein-human.html

Purity

98.0

Smiles

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Molecular Formula

7322 (Gene_ID) P62837-1 (M1-M147) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCL1 (T-Cell Marker) (TCL1/2747R), CF488A conjugate, 0.1mg/mL
BNC882747-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2747R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD51 / Integrin V (ITGAV/1610), CF640R conjugate, 0.1mg/mL
BNC401610-500 1x 500 µL

CD51 / Integrin V (ITGAV/1610), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Amino-3-nitrobenzoic Acid
TRC-A618394-1G 1 g

2-Amino-3-nitrobenzoic Acid

Sign In for Pricing
View Details
RNA Polymerase II (CTD4H8), CF640R conjugate, 0.1mg/mL
BNC402929-100 1x 100 µL

RNA Polymerase II (CTD4H8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL
BNC942259-500 1x 500 µL

Protein Tyrosine Phosphatase, non-receptor type 6 (CPTC-PTPN6-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MFluor™ Green 615 SE
1166-AAT 1 mg

MFluor™ Green 615 SE

Sign In for Pricing
View Details