Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UbcH5b/UBE2D2, Human

The UbcH5b/UBE2D2 protein is an important cellular mediator that accepts ubiquitin from the E1 complex and catalyzes multifunctional “Lys-48”-linked polyubiquitination on target proteins. In addition to its catalytic role, it also concentrates and selectively degrades short-lived proteins and contributes to E6/E6-AP-induced ubiquitination of p53/TP53. UbcH5b/UBE2D2 Protein, Human is the recombinant human-derived UbcH5b/UBE2D2 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UbcH5b/UBE2D2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubch5b-ube2d2-protein-human.html

Purity

98.0

Smiles

MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM

Molecular Formula

7322 (Gene_ID) P62837-1 (M1-M147) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD6 Peptide - middle region (AAP86178)
AAP86178-100UG 100 µg

ENTPD6 Peptide - middle region (AAP86178)

Sign In for Pricing
View Details
Tuba HDR Plasmid (m)
sc-428168-HDR 20 µg

Tuba HDR Plasmid (m)

Sign In for Pricing
View Details
PCDH11X Polyclonal Antibody, Biotin Conjugated
bs-11107R-Biotin 100 µL

PCDH11X Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GSTT1/4 Antibody
8C15930-AAT 50 µg

GSTT1/4 Antibody

Sign In for Pricing
View Details
Recombinant Human TNFAIP6 Protein, N-His
orb2965532-01 50 µg

Recombinant Human TNFAIP6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TNFAIP6 Protein, N-His
orb2965532-02 100 µg

Recombinant Human TNFAIP6 Protein, N-His

Sign In for Pricing
View Details