Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H6, Human (HEK293, His)

B7-H6 Protein, Human (HEK293, His) suppresses the initiation of the “caspase cascade” and induces anti-apoptosis by STAT3 pathway activation to provoke tumorigenesis[1][12].

Product Specifications

Product Name Alternative

B7-H6 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h6-protein-human-hek293-his.html

Purity

95.0

Smiles

DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH

Molecular Formula

374383 (Gene_ID) Q68D85 (D25-S262) (Accession)

Molecular Weight

40-60 kDa

References & Citations

[1]Jing Sun, et al. Clinical significance of novel costimulatory molecule B7-H6 in human breast cancer. Oncol Lett. 2017 Aug;14 (2) :2405-2409.|[2]Yuxuan Hu, et al. Immunological role and underlying mechanisms of B7-H6 in tumorigenesis. Clin Chim Acta. 2020 Mar;502:191-198.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL
BNC470778-100 1x 100 µL

Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL
BNC940261-500 1x 500 µL

CD66 (CEA) (C66/261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details