Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TROY/TNFRSF19, Human (HEK293, His)

TROY Protein also known as TAJ, TNFRSF19, a type I transmembrane receptor, is a member of the TNF receptor superfamily. TROY Protein is involved in embryonic development and the development of skin and hair follicles[1]. TROY Protein inhibits cell proliferation in vitro and shows antitumor activity in xenografted models[2]. TROY/TNFRSF19 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 170 amino acids (M1-L170) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

TROY/TNFRSF19 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/troy-tnfrsf19-protein-human-hek293-his.html

Purity

95.00

Smiles

ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTAL

Molecular Formula

55504 (Gene_ID) Q9NS68-2 (E30-L170) (Accession)

Molecular Weight

25-40kDa

References & Citations

[1]Kojima T, et al. TROY, a newly identified member of the tumor necrosis factor receptor superfamily, exhibits a homology with Edar and is expressed in embryonic skin and hair follicles. J Biol Chem. 2000 Jul 7;275 (27) :20742-7.|[2]Liu X, et al. TROY interacts with RKIP to promote glioma development. Oncogene. 2019 Feb;38 (9) :1544-1559.|[3]Ding Z, et al. TROY signals through JAK1-STAT3 to promote glioblastoma cell migration and resistance. Neoplasia. 2020 Sep;22 (9) :352-364.|[4]Fafilek B, et al. Troy, a tumor necrosis factor receptor family member, interacts with lgr5 to inhibit wnt signaling in intestinal stem cells. Gastroenterology. 2013 Feb;144 (2) :381-391.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-500 1x 500 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (13C4), CF488A conjugate, 0.1mg/mL
BNC880147-500 1x 500 µL

Pgp9.5 (UCHL-1) (13C4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL
BNC940639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details