Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Mouse (HEK293, N-His)

Interleukin-25 (IL-25), also known as IL-17E, belongs to the IL-17 cytokine family. IL-25 activates NF-κB, MAPKs and JAK/STAT signaling pathways[1]. IL-25 exerts singal transduction through receptors composed of IL17RA and IL17RB[7]. IL-25/IL-17E Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IL-25/IL-17E protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Mouse (HEK293, N-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-mouse-n-his.html

Purity

95.0

Smiles

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA

Molecular Formula

140806 (Gene_ID) Q8VHH8 (V17-A169) (Accession)

Molecular Weight

Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ITGA4 shRNA (UAS) - Lentiviral human ITGA4 shRNA (UAS, GFP) plasmid
GTR15299845 1 Vial

Lentiviral human ITGA4 shRNA (UAS) - Lentiviral human ITGA4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS505361 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Bcl-X Antibody
orb2639146 7 mL

Bcl-X Antibody

Sign In for Pricing
View Details
Anti-CD4 Antibody-FITC (8L897)
TMAY-03910F-01 25 Tests

Anti-CD4 Antibody-FITC (8L897)

Sign In for Pricing
View Details
Anti-CD4 Antibody-FITC (8L897)
TMAY-03910F-02 100 Tests

Anti-CD4 Antibody-FITC (8L897)

Sign In for Pricing
View Details
Phospho-TrkB (Tyr817) Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2427535 100 µL

Phospho-TrkB (Tyr817) Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details