Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX5B, Human (His)

The COX5B protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. COX5B Protein, Human (His) is the recombinant human-derived COX5B protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

COX5B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cox5b-protein-human-his.html

Purity

98.0

Smiles

ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

Molecular Formula

1329 (Gene_ID) P10606 (A32-H129) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Human C-P (C-Peptide) ELISA Kit
FY-EH2742S 96 Well

Easypro Human C-P (C-Peptide) ELISA Kit

Sign In for Pricing
View Details
Rho GDIα (C-2) : m-IgGλ BP-HRP Bundle
sc-522783 1 Kit

Rho GDIα (C-2) : m-IgGλ BP-HRP Bundle

Sign In for Pricing
View Details
Polyprotein pp62 / Ba71V-94 / ASFV-p35 Polyclonal Antibody
ANT-13846-100ug 100 µg

Polyprotein pp62 / Ba71V-94 / ASFV-p35 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free
orb1179077-01 5 µg

Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free
orb1179077-02 20 µg

Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free

Sign In for Pricing
View Details
Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free
orb1179077-03 100 µg

Recombinant IL-12 p35 (Interleukin-12 p35), Human, Animal-Free

Sign In for Pricing
View Details