Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Decorin/PGS2, Rat (HEK293, His)

Decorin/PGS2 protein is involved in regulating extracellular matrix dynamics, affecting the rate of fibril formation and participating in rat cervical dilation. It has versatile binding properties, interacting with type I and type II collagen, fibronectin, and TGF-β, suggesting involvement in a variety of cellular processes. Decorin/PGS2 Protein, Rat (HEK293, His) is the recombinant rat-derived Decorin/PGS2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Decorin/PGS2 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/decorin-pgs2-protein-rat-hek293-his.html

Purity

96.00

Smiles

GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWEFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNHLKELPEKLPKTLQELRLHDNEITKLKKSVFNGLNRMIVIELGGNPLKNSGIENGALQGMKGLGYIRISDTNITAIPQGLPTSISELHLDGNKIAKVDAASLKGMSNLSKLGLSFNSITVVENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYVQVVYLHNNNISEVGQHDFCLPSYQTRKTSYTAVSLYSNPVRYWQIHPHTFRCVFGRSTIQLGNYK

Molecular Formula

29139 (Gene_ID) Q01129 (G17-K354) (Accession)

Molecular Weight

Approximately 43-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZMPSTE24, ID (ZMPSTE24, FACE1, STE24, CAAX prenyl protease 1 homolog, Farnesylated proteins-converting enzyme 1, Prenyl protein-specific endoprotease 1, Zinc metalloproteinase Ste24 homolog) (AP) discontinued
044096-AP 200 µL

ZMPSTE24, ID (ZMPSTE24, FACE1, STE24, CAAX prenyl protease 1 homolog, Farnesylated proteins-converting enzyme 1, Prenyl protein-specific endoprotease 1, Zinc metalloproteinase Ste24 homolog) (AP) discontinued

Sign In for Pricing
View Details
RPL18P7 3'UTR GFP Stable Cell Line
TU070877 1.0 mL

RPL18P7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Myomesin-1 rabbit pAb
ES7870-01 50 µL

Myomesin-1 rabbit pAb

Sign In for Pricing
View Details
Myomesin-1 rabbit pAb
ES7870-02 100 µL

Myomesin-1 rabbit pAb

Sign In for Pricing
View Details
PPP2R2B Antibody - middle region (ARP78320_P050)
ARP78320_P050 100 µL

PPP2R2B Antibody - middle region (ARP78320_P050)

Sign In for Pricing
View Details
Anti-STX16 Antibody (R1D22)
RHA26302 100 μg

Anti-STX16 Antibody (R1D22)

Sign In for Pricing
View Details