ISCU, Human (sf9, His)
ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) . ISCU Protein, Human (sf9, His) is the recombinant human-derived ISCU protein, expressed by sf9 insect cells , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ISCU Protein, Human (sf9, His), Human, Sf9 insect cells
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/iscu-protein-human-baculovirus-his-myc.html
Purity
96.00
Smiles
YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
Molecular Formula
23479 (Gene_ID) Q9H1K1-1 (Y35-K167) (Accession)
Molecular Weight
Approximately 17 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Modifier 2, SUMO-2, Ubiquitin-like Protein SMT3B, SMT3 Homolog 2, Sentrin-2, HSMT3, SUMO-3, SMT3B, SMT3H2, Small Ubiquitin-related Modifier 3, SUMO-3, Ubiquitin-like Protein SMT3A, SMT3 Homolog 1, SUMO-2, SMT3A, SMT3H1) (Biotin) discontinued