Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISCU, Human (sf9, His)

ISCU is an important mitochondrial scaffolding protein in the ISC assembly complex and forms the structural basis of [2Fe-2S] cluster assembly. ISCU relies on FXN to centrally receive persulfide during de novo synthesis initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) . ISCU Protein, Human (sf9, His) is the recombinant human-derived ISCU protein, expressed by sf9 insect cells , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ISCU Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/iscu-protein-human-baculovirus-his-myc.html

Purity

96.00

Smiles

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Molecular Formula

23479 (Gene_ID) Q9H1K1-1 (Y35-K167) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
BNC470994-100 1x 100 µL

TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-100 1x 100 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details