Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PF-4/CXCL4, Mouse (HEK293, Fc)

PF-4/CXCL4 is a member of the CXC chemokine family that is released from the alpha-granules of activated platelets. PF-4/CXCL4 binds with high affinity to heparin, with antiheparin, antiangiogenic and immunomodulatory activities. PF-4/CXCL4 plays a role in hematopoiesis and immune cell modulation[1][2]. PF-4/CXCL4 Protein, Mouse (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 76 amino acids (V30-S105) .

Product Specifications

Product Name Alternative

PF-4/CXCL4 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pf-4-cxcl4-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Molecular Formula

56744 (Gene_ID) Q9Z126 (V30-S105) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Lasagni L, et al. PF-4/CXCL4 and CXCL4L1 exhibit distinct subcellular localization and a differentially regulated mechanism of secretion. Blood. 2007 May 15;109 (10) :4127-34.|[2]Pieter Ruytinx, et al. CXCL4 and CXCL4L1 in cancer. Cytokine. 2018 Sep;109:65-71.|[3]Gabriele Domschke, et al. CXCL4-induced macrophages in human atherosclerosis. Cytokine. 2019 Oct;122:154141.|[4]Merry L Lindsey, et al. Exogenous CXCL4 infusion inhibits macrophage phagocytosis by limiting CD36 signalling to enhance post-myocardial infarction cardiac dilation and mortality.Cardiovasc Res. 2019 Feb 1;115 (2) :395-408.|[5]Mirko Moreno Zaldivar, et al. CXC chemokine ligand 4 (Cxcl4) is a platelet-derived mediator of experimental liver fibrosis. Hepatology. 2010 Apr;51 (4) :1345-53.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mpzl1 Mouse siRNA Oligo Duplex (Locus ID 68481)
SR426018 1 Kit

Mpzl1 Mouse siRNA Oligo Duplex (Locus ID 68481)

Sign In for Pricing
View Details
ADHγ Double Nickase Plasmid (h)
sc-402261-NIC 20 µg

ADHγ Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Lypla2 Rat shRNA Lentiviral Particle (Locus ID 83510)
TL711307V 500 µL Each

Lypla2 Rat shRNA Lentiviral Particle (Locus ID 83510)

Sign In for Pricing
View Details
Alpha 2 Catenin Rabbit Polyclonal Antibody
orb77051 100 µg

Alpha 2 Catenin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived aminoglycoside N (3')-acetyltransferase-like protein yokD
MBS1161085-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis SPBc2 prophage-derived aminoglycoside N (3')-acetyltransferase-like protein yokD

Sign In for Pricing
View Details
Recombinant Bacillus subtilis SPBc2 prophage-derived aminoglycoside N (3')-acetyltransferase-like protein yokD
MBS1161085-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis SPBc2 prophage-derived aminoglycoside N (3')-acetyltransferase-like protein yokD

Sign In for Pricing
View Details