Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Mouse (HEK293, His)

The carbonic anhydrase 14 (CA14) protein catalyzes the reversible hydration of carbon dioxide, converting it into bicarbonate ions and protons.Its enzymatic activity is essential for physiological processes, regulating pH and maintaining acid-base balance.Carbonic Anhydrase 14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 14 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Molecular Formula

23831 (Gene_ID) Q9WVT6 (A16-M290) (Accession)

Molecular Weight

Approximately 41-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA safeguard Reagent
TRI-C54M1 120mL

RNA safeguard Reagent

Sign In for Pricing
View Details
Cdk5 Protein, Human, Recombinant (GST Tag)
PH50217I6 50 µg

Cdk5 Protein, Human, Recombinant (GST Tag)

Sign In for Pricing
View Details
Eif2ak4 Mouse shRNA Lentiviral Particle (Locus ID 27103)
TL511649V 500 µL Each

Eif2ak4 Mouse shRNA Lentiviral Particle (Locus ID 27103)

Sign In for Pricing
View Details
ELF4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
19206064 1.0 µg DNA

ELF4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human IFNg / Granzyme B Dual Fluorospot Set, 10 x 96-well (plates not included)
EA102067 10x 96 Well (Plates Not Included)

Human IFNg / Granzyme B Dual Fluorospot Set, 10 x 96-well (plates not included)

Sign In for Pricing
View Details
WAVE3 HDR Plasmid (h)
sc-404650-HDR 20 µg

WAVE3 HDR Plasmid (h)

Sign In for Pricing
View Details