Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus sp. group G Immunoglobulin G-binding protein G (spg), partial

Product Specifications

Product Name Alternative

IgG-binding protein G

Abbreviation

Recombinant Streptococcus sp. group G spg protein, partial

Gene Name

Spg

UniProt

P19909

Expression Region

291-497aa

Organism

Streptococcus sp. group G

Target Sequence

IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-6917-5p mimic
HY-R03556-01 5 nmol

Mmu-miR-6917-5p mimic

Sign In for Pricing
View Details
Mmu-miR-6917-5p mimic
HY-R03556-02 20 nmol

Mmu-miR-6917-5p mimic

Sign In for Pricing
View Details
D-Trehalose Dihydrate
42000129-4 10 g

D-Trehalose Dihydrate

Sign In for Pricing
View Details
DARS Antibody, HRP conjugated
A18974-100UG 100 µg

DARS Antibody, HRP conjugated

Sign In for Pricing
View Details
Goat anti-Human IgG (H&L) - Affinity Pure, TRITC Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins
MBS686071-01 1 mg

Goat anti-Human IgG (H&L) - Affinity Pure, TRITC Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins

Sign In for Pricing
View Details
Goat anti-Human IgG (H&L) - Affinity Pure, TRITC Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins
MBS686071-02 5x 1 mg

Goat anti-Human IgG (H&L) - Affinity Pure, TRITC Conjugate, min x w/bovine, goat, mouse or rabbit serum proteins

Sign In for Pricing
View Details