Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (GST)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (GST) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (GST), Sheep, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-gst.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI4H7]
TA806272S 30 µL

NR2E3 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

Ask
View Details
Mouse Monoamine Oxidase A (MAOA) ELISA Kit
EKN49535 96 Tests

Mouse Monoamine Oxidase A (MAOA) ELISA Kit

Ask
View Details
Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody
abx334423-01 20 µg

Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody

Ask
View Details
Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody
abx334423-02 50 µg

Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody

Ask
View Details
Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody
abx334423-03 100 µg

Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody

Ask
View Details
Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody
abx334423-04 200 µg

Overexpressed In Colon Carcinoma 1 Protein (OCC1) Antibody

Ask
View Details