Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt5-protein-human-his.html

Purity

95.00

Smiles

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Formula

11164 (Gene_ID) Q9UKK9 (M1-F219) (Accession)

Molecular Weight

30-35 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR25 Human Gene Knockout Kit (CRISPR)
KN422479 1 Kit

PRR25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]
AN00323M-01 20 Tests

Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]
AN00323M-02 100 Tests

Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]
AN00323M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD146 Antibody[P1H12]

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL
BNC041778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(E)-(4S)-4,5-Isopropylidene-dioxy-1-(2-hydroxy-5-fluorophenyl)propenone
TRC-I824960-500MG 500 mg

(E)-(4S)-4,5-Isopropylidene-dioxy-1-(2-hydroxy-5-fluorophenyl)propenone

Sign In for Pricing
View Details