Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt5-protein-human-his.html

Purity

95.00

Smiles

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Formula

11164 (Gene_ID) Q9UKK9 (M1-F219) (Accession)

Molecular Weight

30-35 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin alpha 4 Recombinant Rabbit Monoclonal Antibody [JA09-36]
ET1704-31 100 µL

Integrin alpha 4 Recombinant Rabbit Monoclonal Antibody [JA09-36]

Sign In for Pricing
View Details
Nortilidine Hydrochloride
TRC-N831000-25MG 25 mg

Nortilidine Hydrochloride

Sign In for Pricing
View Details
CNOT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]
TA504474BM 100 µL

CNOT4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B2]

Sign In for Pricing
View Details
Ythdf2 Mouse Gene Knockout Kit (CRISPR)
KN519569 1 Kit

Ythdf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMIE (NM_147196) Human Recombinant Protein
TP320050M 100 µg

TMIE (NM_147196) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381D-01 20 Tests

PE Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details