Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt5-protein-human-his.html

Purity

95.00

Smiles

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Formula

11164 (Gene_ID) Q9UKK9 (M1-F219) (Accession)

Molecular Weight

30-35 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary
CS702263 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
MST1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]
TA808500BM 100 µL

MST1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A10]

Sign In for Pricing
View Details
(rac./meso)-Astaxanthin
TRC-A788715-2.5MG 2.5 mg

(rac./meso)-Astaxanthin

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS806962 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
P73 (Tumor Suppressor) (P73/2531), CF647 conjugate, 0.1mg/mL
BNC472531-100 1x 100 µL

P73 (Tumor Suppressor) (P73/2531), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Angiotensin Converting Enzyme 1 (ACE) Rabbit Monoclonal Antibody
TA423283 100 µL

Angiotensin Converting Enzyme 1 (ACE) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details