Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt5-protein-human-his.html

Purity

95.00

Smiles

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Formula

11164 (Gene_ID) Q9UKK9 (M1-F219) (Accession)

Molecular Weight

30-35 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-R0163-01 24 Tests

Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-R0163-02 48 Tests

Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit
E-CL-R0163-03 96 Tests

Rat COL1α2 (Collagen Type I Alpha 2) CLIA Kit

Sign In for Pricing
View Details
Ethyl Isonicotinimidate Hydrochloride
TRC-E259000-1G 1 g

Ethyl Isonicotinimidate Hydrochloride

Sign In for Pricing
View Details
Emc6 (NM_025318) Mouse Tagged ORF Clone
MG200421 10 µg

Emc6 (NM_025318) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS628910 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details