Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUDT5, Human (His)

The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

NUDT5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nudt5-protein-human-his.html

Purity

95.00

Smiles

ESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Molecular Formula

11164 (Gene_ID) Q9UKK9 (M1-F219) (Accession)

Molecular Weight

30-35 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SET and MYND domain-containing protein 3 (SMYD3) Mouse ELISA Kit
H0092 96 Tests

SET and MYND domain-containing protein 3 (SMYD3) Mouse ELISA Kit

Sign In for Pricing
View Details
TGFA Antibody
MBS9507404-01 0.05 mL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
MBS9507404-02 0.1 mL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
MBS9507404-03 5x 0.1 mL

TGFA Antibody

Sign In for Pricing
View Details
TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)
MBS6185099-01 0.1 mL

TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)

Sign In for Pricing
View Details
TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)
MBS6185099-02 5x 0.1 mL

TPT1 (Tumor Protein, Translationally-controlled 1, FLJ27337, HRF, TCTP, p02) (PE)

Sign In for Pricing
View Details