Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-II (APOA2)

Product Specifications

Product Name Alternative

(Apo-AII) (ApoA-II) (Apolipoprotein A2)

Abbreviation

Recombinant Human APOA2 protein

Gene Name

APOA2

UniProt

P02652

Expression Region

24-100aa

Organism

Homo sapiens (Human)

Target Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.7 kDa

References & Citations

"Expression and purification of recombinant human apolipoprotein A-II in Pichia pastoris." Su M., Qi Y., Wang M., Chang W., Peng S., Xu T., Wang D. Assay Drug Dev. Technol. 11:501-507 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (Biotin)
MBS6391827-01 0.1 mL

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (Biotin)

Sign In for Pricing
View Details
RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (Biotin)
MBS6391827-02 5x 0.1 mL

RAD17 (Cell Cycle Checkpoint Protein RAD17, hRad17, RF-C/Activator 1 Homolog, R24L, FLJ41520) (Biotin)

Sign In for Pricing
View Details
CA7 (NM_001014435) Human Over-expression Lysate
LH03880V 100 µg

CA7 (NM_001014435) Human Over-expression Lysate

Sign In for Pricing
View Details
ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE)
MBS6187341-01 0.1 mL

ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE)

Sign In for Pricing
View Details
ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE)
MBS6187341-02 5x 0.1 mL

ASS1 (Argininosuccinate Synthetase 1, ASS, CTLN1) (PE)

Sign In for Pricing
View Details
Magic™ Human CLDN18.2 MIAPaCa2 Cell Line
S01YF-0123-KX160 1 Vial

Magic™ Human CLDN18.2 MIAPaCa2 Cell Line

Sign In for Pricing
View Details