Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Apolipoprotein A-II (APOA2)

Product Specifications

Product Name Alternative

(Apo-AII) (ApoA-II) (Apolipoprotein A2)

Abbreviation

Recombinant Human APOA2 protein

Gene Name

APOA2

UniProt

P02652

Expression Region

24-100aa

Organism

Homo sapiens (Human)

Target Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.7 kDa

References & Citations

"Expression and purification of recombinant human apolipoprotein A-II in Pichia pastoris." Su M., Qi Y., Wang M., Chang W., Peng S., Xu T., Wang D. Assay Drug Dev. Technol. 11:501-507 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chymotrypsin Like Elastase Family Member 2A (CELA2A) Antibody
abx027734-01 80 µL

Chymotrypsin Like Elastase Family Member 2A (CELA2A) Antibody

Sign In for Pricing
View Details
Chymotrypsin Like Elastase Family Member 2A (CELA2A) Antibody
abx027734-02 400 µL

Chymotrypsin Like Elastase Family Member 2A (CELA2A) Antibody

Sign In for Pricing
View Details
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody
MB4157-01 25 µL

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody

Sign In for Pricing
View Details
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody
MB4157-02 100 µL

LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody

Sign In for Pricing
View Details
ELF5 Protein Vector (Human) (pPB-N-His)
PV014086 500 ng

ELF5 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit luteinizing hormone (LH) Elisa Kit
EK70004Rb 96 Well

Rabbit luteinizing hormone (LH) Elisa Kit

Sign In for Pricing
View Details