Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P24, HIV-1 (AAB50258, His)

The capsid protein p24 forms the conical core of the genome RNA-nucleocapsid complex in the virion. Promote immune invasion by hiding the viral DNA detected by CGAS. The viral capsid protein p24 is considered to be another early virological biomarker of infection. p24 Protein, HIV-1 (AAB50258, His) is the recombinant Virus-derived p24 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

P24 Protein, HIV-1 (AAB50258, His), Virus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hiv-1-p24-protein-aab50258-his.html

Purity

98.0

Smiles

PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL

Molecular Formula

155030 (Gene_ID) P04591-1/AAB50258 (P133-L363) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitously expressed transcript Rabbit Polyclonal Antibody (Cy5)
orb886639 100 µL

Ubiquitously expressed transcript Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Integrin Alpha V Rabbit pAb, BF700 conjugated
orb2854929 100 µL

Integrin Alpha V Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
PE Anti-mouse CD150 (TC15-12F12.2)
PE-09790-01 50 Tests

PE Anti-mouse CD150 (TC15-12F12.2)

Sign In for Pricing
View Details
PE Anti-mouse CD150 (TC15-12F12.2)
PE-09790-02 100 Tests

PE Anti-mouse CD150 (TC15-12F12.2)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CML41 Polyclonal Antibody
MBS9002292 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) CML41 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pig Interleukin-27 subunit alpha (IL27)
MBS1307963-01 0.02 mg (E-Coli)

Recombinant Pig Interleukin-27 subunit alpha (IL27)

Sign In for Pricing
View Details