Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Human (HEK293, His)

Noggin is an antagonist of bone morphogenetic proteins (BMPs) and a member of the TGF-β superfamily, existing as a homodimer. Noggin binds to BMP-2/-4/-7 and inhibits their binding to BMPR-I/II receptors, thereby synergistically inducing bone differentiation in HMSCs, maintaining pluripotency in hESCs, inhibiting angiogenesis in HUVECs, and promoting myelination in oligodendrocytes, exerting neural activity[1][2][3][4]. Noggin Protein, Human (HEK293, Fc) is a recombinant human Noggin protein expressed in HEK293 cells with C-His tag.

Product Specifications

Product Name Alternative

Noggin Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-human-hek293-his.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

9241 (Gene_ID) Q13253/NP_005441.1 (Q28-C232) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[2]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[3]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009 Dec;23 (12) :4126-34.|[4]Izrael M, et al. Human oligodendrocytes derived from embryonic stem cells: Effect of noggin on phenotypic differentiation in vitro and on myelination in vivo. Mol Cell Neurosci. 2007 Mar;34 (3) :310-23.|[5]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[6]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[7]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMO1 Protein Vector (Human) (pPM-C-His)
PV016500 500 ng

FMO1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Cow Ribose-5-phosphate isomerase (RPIA) ELISA Kit
abx516353 96 Tests

Cow Ribose-5-phosphate isomerase (RPIA) ELISA Kit

Sign In for Pricing
View Details
Human F9 (Coagulation Factor IX) ELISA Kit
RE1423H-01 48 Tests

Human F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
Human F9 (Coagulation Factor IX) ELISA Kit
RE1423H-02 96 Tests

Human F9 (Coagulation Factor IX) ELISA Kit

Sign In for Pricing
View Details
ELISA kit for Mouse Kinetochore protein Spc25 (SPC25)
KTE70388-01 48 Tests

ELISA kit for Mouse Kinetochore protein Spc25 (SPC25)

Sign In for Pricing
View Details
ELISA kit for Mouse Kinetochore protein Spc25 (SPC25)
KTE70388-02 96 Tests

ELISA kit for Mouse Kinetochore protein Spc25 (SPC25)

Sign In for Pricing
View Details